DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG33226

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:267 Identity:75/267 - (28%)
Similarity:117/267 - (43%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDSVQ----IQPRIIGGHVSSIKEEKYLVQV-TTSEELCGGSLVKPRWVITAAHCVYN-KNKNDF 83
            |:.||    ::.:|:|||.:.||...::||: ......|||||:...:|:|||||... :.|..|
  Fly    34 PNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYRLKVRF 98

  Fly    84 KIYGG-------ASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAA 141
            ..|.|       :|....|:.....|..|.:...: |...|.|: ||.|.:..:..|::|.|:..
  Fly    99 GRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY-RDYHNYDI-ALFLLAKPVRYNVQTRPICV 161

  Fly   142 ----------QSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWS-----RASCVSAFRGIHR 191
                      |.:...|:..|:|||       ||..::.|.::...|     |..|...|.  .:
  Fly   162 LQTSNKDKLRQFLNYVAMFNVTGWG-------KTESQLTSTILQTTSLFHLDRKFCAQIFD--RK 217

  Fly   192 ITRSMVCAARLYKKDSCDGDSGGPL--------VYRGQLAGIVSFGY-GCASALPGIYTSVPEIR 247
            |....:||.. .:..:|.|||||||        |.|..|.||:|:|. .|....  ::|:|....
  Fly   218 IGWPHICAGH-SQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREVT--VFTNVLRYS 279

  Fly   248 DWFQRVV 254
            :|.:.:|
  Fly   280 NWIRDIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/248 (28%)
Tryp_SPc 34..253 CDD:238113 71/251 (28%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 71/251 (28%)
Tryp_SPc 47..282 CDD:214473 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.