DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Prss2

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:257 Identity:83/257 - (32%)
Similarity:133/257 - (51%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVIT 70
            :.:|..:.::|   |..|.|  |....:|:||:........|.|.:.:....|||||:..:||::
  Rat     1 MRALLFLALVG---AAVAFP--VDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVS 60

  Fly    71 AAHCVYNK-----NKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM- 129
            ||||..::     .:::..:..|.........:|:       .|:|:|||||.|:..::|:|.: 
  Rat    61 AAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIK-------HPNFDRKTLNNDIMLIKLSSPVK 118

  Fly   130 IGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITR 194
            :.|.:.|:.|.:...||.....:||||...:......:.:..:..|:..:|.|.:::.|  :||.
  Rat   119 LNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPG--KITD 181

  Fly   195 SMVCAARLY-KKDSCDGDSGGPLVYRGQLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVV 254
            :|||...|. .||||.||||||:|..|:|.||||:||||| ...||:||.|....||.|..:
  Rat   182 NMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/223 (33%)
Tryp_SPc 34..253 CDD:238113 77/226 (34%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 75/224 (33%)
Tryp_SPc 24..242 CDD:238113 77/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.