DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Klkb1

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:250 Identity:77/250 - (30%)
Similarity:124/250 - (49%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SVQIQPRIIGGHVSSIKEEKY----LVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKND-FKIY 86
            :.:|..||:||..||:.|..:    .|::.:...:||||::..:|::|||||.......| ::||
  Rat   384 TTKINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIY 448

  Fly    87 GGASN-----QAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIE---TIPLAAQS 143
            ||..|     ...|::.|:.   :.|...:.....:.|:|.::|.:.:.....:   .:|..|.:
  Rat   449 GGILNLSEITNKTPFSSIKE---LIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADT 510

  Fly   144 VPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKK--- 205
            ........|:|||: |.:..:|...:....:|:.....|...:|. :.||:.|:||.  ||:   
  Rat   511 NTIYTNCWVTGWGY-TKERGETQNILQKATIPLVPNEECQKKYRD-YVITKQMICAG--YKEGGI 571

  Fly   206 DSCDGDSGGPLVY----RGQLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVE 255
            |:|.||||||||.    |.||.||.|:|.||| ...||:||.|.|..||....::
  Rat   572 DACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQ 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/236 (31%)
Tryp_SPc 34..253 CDD:238113 75/239 (31%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 75/237 (32%)
Tryp_SPc 391..621 CDD:238113 74/236 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.