DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG30289

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:126/261 - (48%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGG-------- 88
            |.|.||..::|:|..::|.|.:|:. |||||:..::|:||||||   :..|..:..|        
  Fly    40 PNIFGGAKTNIQENPWMVLVWSSKP-CGGSLIARQFVLTAAHCV---SFEDLYVRLGDYETLDPM 100

  Fly    89 ---ASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLN-----SD-------MIGANIETIP 138
               .:|...|.....:||...:..::|..||..|:|.||::     ||       ::|..:::||
  Fly   101 PYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIP 165

  Fly   139 LAAQSVPARALVKVSGWGFLTADATKTAE----RVHSVLVPMWSRASCVSAFRGIHRITRSMVCA 199
                      :..|:|||     .|:..:    .:::.|..| ..:.|...|.  .:..||.:||
  Fly   166 ----------MFTVTGWG-----ETEYGQFSRILLNATLYNM-DISYCNIKFN--KQADRSQICA 212

  Fly   200 ARLYKKDSCDGDSGGPLV----YRGQLA----GIVSFG-YGCASALPGIYTSVPEIRDW-FQRVV 254
            .. :..::|.|||||||.    |..:|.    |:||:| ..||:.:.|:||:|...|:| |.::|
  Fly   213 GS-HTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFNKMV 276

  Fly   255 E 255
            :
  Fly   277 Q 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/251 (29%)
Tryp_SPc 34..253 CDD:238113 74/255 (29%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 72/251 (29%)
Tryp_SPc 42..271 CDD:238113 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.