DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG30288

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:256 Identity:76/256 - (29%)
Similarity:113/256 - (44%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVTTS-EELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQAGPY 96
            ||.||..:.::...::|:|..| :.:|||||:..|:|:||.||:.....|         .:.|.|
  Fly    42 RIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPMYMN---------VRLGEY 97

  Fly    97 AVIRTV----DYI----AIRPDFNRKTLN----MDVAALRLNSDMIGAN-IETIPLAAQSV---- 144
            .....:    |::    |...|.:||.::    .|:..||:...:|.:| :..|.|.....    
  Fly    98 DTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGN 162

  Fly   145 PARAL-VKVSGWGFLTADATKTAERVHSVL---VPMWSRASCVSAFRGIHRITRSMVCAARLYKK 205
            |...| ...:|||  |....:..:|:.:..   :|.|   ||....|   .:..|.:||.. |..
  Fly   163 PLSILRFNFTGWG--TNSDGEEQDRLQTATLQQLPQW---SCERPGR---PLDISYICAGS-YIS 218

  Fly   206 DSCDGDSGGPL----VYRGQ----LAGIVSFGYGCASALPGIYTSVPEIRDWFQRVVEQHS 258
            |||.|||||||    .:.||    ..|:.|.|....|.| ||||:|....||...|::.||
  Fly   219 DSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGL-GIYTNVTHFTDWILDVIQNHS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 71/245 (29%)
Tryp_SPc 34..253 CDD:238113 72/248 (29%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 72/246 (29%)
Tryp_SPc 45..270 CDD:238113 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.