DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG30287

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:312 Identity:86/312 - (27%)
Similarity:133/312 - (42%) Gaps:101/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VQILGFHSAVYAHPDSVQIQP-----------------RIIGGHVSSIKEEKYLVQVTTSEEL-C 58
            ||:|...:.|:.   .||.||                 |:|.|..:.:....::|.:.....: |
  Fly     6 VQLLLLIALVFL---KVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKC 67

  Fly    59 GGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVD---YIAI-RPDFNRKTLNM- 118
            ||||:.||:|:||||| .::.|:...:      :.|.|.|.:.||   |..| ||    :.:|: 
  Fly    68 GGSLITPRYVLTAAHC-KSETKSQLTV------RLGDYDVNQAVDCSSYGCIPRP----REINVT 121

  Fly   119 --------------DVAALRLNSDM-IGANIETIPLAA-----QSVPARALVK--VSGWGFLTAD 161
                          |:|.|||.:.: .|.||.:|.|..     .|...:.|||  .:|||     
  Fly   122 RTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWG----- 181

  Fly   162 ATKTAERVHSVLVPMWSRAS--------CVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVY 218
              :|..|::|   |:..:||        |...|.  .::.:|.:|.|. ....:|.|||||||..
  Fly   182 --RTESRINS---PVLQQASLTHHHLSYCAQVFG--KQLDKSHICVAS-STGSTCQGDSGGPLTA 238

  Fly   219 RGQ--------LAGIVSFG----YGCASALPGIYTSVPEIRDWFQRVVEQHS 258
            |.:        |.|:||:|    :|     |.:||:|....:|    :|.|:
  Fly   239 RVRIGSERRVILFGVVSYGAVHCFG-----PTVYTNVIHFANW----IELHT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 75/263 (29%)
Tryp_SPc 34..253 CDD:238113 75/266 (28%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 76/268 (28%)
Tryp_SPc 42..280 CDD:238113 76/270 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.