DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG30088

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:253 Identity:72/253 - (28%)
Similarity:116/253 - (45%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IQPRIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCV----------YNKNKNDF 83
            :..||:.|..:.:|...::..:..|.|: |||:::..|:::|||||:          ::..:|..
  Fly    41 VATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPD 105

  Fly    84 KIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARA 148
            ...|..|..|..:.::....|    ..|:|...| |:|.|:|:.: |..|:...|:.....||.|
  Fly   106 CQGGSCSPPAEEFDIVLATKY----KRFDRFLAN-DIALLKLSRN-IRFNVHIQPICLILNPAAA 164

  Fly   149 ----LVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCD 209
                ..:..|||  ..:...:|..:.:.::..:....|.|...  ..||.:.:|.. ....|:|.
  Fly   165 PNVHEFQAFGWG--QTETNHSANVLQTTVLTRYDNRHCRSVLS--MPITINQLCVG-FQGSDTCS 224

  Fly   210 GDSGGPLV----YRG-----QLAGIVSFGYG-CASALPGIYTSVPEIRDWFQRVVEQH 257
            ||||||||    |.|     || ||||||.. |.|  ||:||.||....|.:.|::.:
  Fly   225 GDSGGPLVTKVNYDGVWRYLQL-GIVSFGDDKCQS--PGVYTYVPNYIRWIRYVMQSN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/240 (29%)
Tryp_SPc 34..253 CDD:238113 70/243 (29%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 70/241 (29%)
Tryp_SPc 45..273 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.