DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG30082

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:275 Identity:73/275 - (26%)
Similarity:121/275 - (44%) Gaps:50/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLVQILGFHSAVYAHPD---SVQIQP--RIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWV 68
            |||.:.....|.:..|:   ::.:.|  ||:||..:.|....:|..:..:..| |.|:|:..|:|
  Fly    11 FLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFV 75

  Fly    69 ITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIA----------------IRPDF-NRKTL 116
            :|||||:::.:....::        |.|.....:|..:                |...| .|:..
  Fly    76 LTAAHCLHSFHLLTVRL--------GEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDS 132

  Fly   117 NMDVAALRLNSDMI-GANIETIPLAAQ--SVPARALVKVSGWGFLTADATKTAERVHSVLVPMWS 178
            ..|:..|:||..:: ...|..|.|...  .||..:..:.:|||.:  |...||..:.:|.:....
  Fly   133 RNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKI--DLINTATVLQTVNLIRLD 195

  Fly   179 RASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPL--------VYRGQLAGIVSFG-YGCAS 234
            ::.|..:.|  ..::....||.: ::.|:|.|||||||        :.|....||||:| |.|..
  Fly   196 QSDCERSLR--TSLSYGQFCAGQ-WRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG 257

  Fly   235 ALPGIYTSVPEIRDW 249
              ||:||.||...:|
  Fly   258 --PGVYTYVPSFTNW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 66/245 (27%)
Tryp_SPc 34..253 CDD:238113 66/246 (27%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 67/247 (27%)
Tryp_SPc 40..274 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.