DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Prss58

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_778185.1 Gene:Prss58 / 232717 MGIID:3608323 Length:241 Species:Mus musculus


Alignment Length:221 Identity:65/221 - (29%)
Similarity:104/221 - (47%) Gaps:19/221 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQAGPY-AVIRTVDYIAI--R 108
            |||.:.:....|.|.|:.|.||||||||    |..:.::..|.:|.|.|. ..:...||..|  .
Mouse    30 YLVYLKSDYLPCTGVLIHPLWVITAAHC----NLPNLQVILGITNPADPMERDVEVSDYEKIFHH 90

  Fly   109 PDFNRKTLNMDVAALRLNSDMIGAN-IETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSV 172
            |:|...:::.|:..::|...:..:| .:.:.|....|...|:..||.|.:...|.||..:.:.:|
Mouse    91 PNFLVSSISHDLLLIKLKRRIKHSNYAKAVKLPQHIVSVNAMCSVSTWAYNLCDVTKDPDSLQTV 155

  Fly   173 LVPMWSRASCVSAFRGIHRITRSMVCAA-----RLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGC 232
            .|.:.|:|.|.:|::... ||.:|:|..     ||    .|...:..|.|..|.|.||:|:..||
Mouse   156 NVTVISKAECRNAYKAFD-ITENMICVGIVPGRRL----PCKEVTAAPAVCNGVLYGILSYADGC 215

  Fly   233 A-SALPGIYTSVPEIRDWFQRVVEQH 257
            . .|..|||.|:.....|.:..::.:
Mouse   216 VLRADVGIYASIFHYLPWIEDTMKNN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 64/211 (30%)
Tryp_SPc 34..253 CDD:238113 65/215 (30%)
Prss58NP_778185.1 Tryp_SPc 29..237 CDD:238113 65/215 (30%)
Tryp_SPc 29..234 CDD:214473 64/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6852
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.