DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and try-1

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:240 Identity:80/240 - (33%)
Similarity:120/240 - (50%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DSVQIQPRIIGGHVSSIKEEKYLVQVTT--SEELCGGSLVKPRWVITAAHCVYNKNKN----DFK 84
            |.|.:..|:|||..||.....:.||:.:  ....|||||:.|.:|:||||| :.|::.    ..:
 Worm    50 DYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHC-FAKDRRPTSYSVR 113

  Fly    85 IYGGASNQAGPYAVIRTVDYIAIRPDFN-RKTLNMDVAALRLNSDMIGANIETIPLAAQSVPA-- 146
            :.|..|....|:.|..    ::|.|.:| ....:.|.|.:|::.. :..:....|:...|:||  
 Worm   114 VGGHRSGSGSPHRVTA----VSIHPWYNIGFPSSYDFAIMRIHPP-VNTSTTARPICLPSLPAVE 173

  Fly   147 RALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRI-TRSMVCAARLYKK-DSCD 209
            ..|..|:|||.....::.:|..:..:.||:.|...|.|....|.|| ..||:||...|.| |||.
 Worm   174 NRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQ 238

  Fly   210 GDSGGPLVY----RGQLAGIVSFGYGCA-SALPGIYTSVPEIRDW 249
            |||||||:.    ..:|.|:||:|.||| ..:||:|.:|.....|
 Worm   239 GDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 77/231 (33%)
Tryp_SPc 34..253 CDD:238113 77/232 (33%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.