DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG12256

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:272 Identity:75/272 - (27%)
Similarity:119/272 - (43%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YAHPDSVQIQPRIIGGHVSSIKEEKYL-----VQVTT----SEELCGGSLVKPRWVITAAHCVYN 77
            |.....:..|.|::||:  .:.|::|:     :|..|    ....|||||:.|..|:||||||..
  Fly    35 YFEEADLNSQERVVGGY--DVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNG 97

  Fly    78 KNKN---------DFKIYGGASNQAGPY--------AVIRTVDYIAIRPDF---NRKTLNMDVAA 122
            :|.:         |.....|..:|...|        .|...:..:.|.|.|   .::...:||: 
  Fly    98 QNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTIDVS- 161

  Fly   123 LRLNSDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPM----WSRASCV 183
               .|||:||:.|              |.::|||.:....|....:..:||..:    .|.:.|.
  Fly   162 ---GSDMVGADQE--------------VLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCK 209

  Fly   184 SAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRG----QLAGIVSFGYG-CASALPGIYTSV 243
            ..   :.::|.:.:||...:.|.:|:||||||||.:.    :..|:||:|.. |||..|.:||.|
  Fly   210 ET---MTQLTDTEICALERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRV 271

  Fly   244 PEIRDWF-QRVV 254
            .....|. :|:|
  Fly   272 SMFDGWIKERMV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/253 (28%)
Tryp_SPc 34..253 CDD:238113 70/257 (27%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 70/254 (28%)
Tryp_SPc 47..280 CDD:238113 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.