DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and f12

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:241 Identity:75/241 - (31%)
Similarity:112/241 - (46%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNK-NKNDFKIYGGAS--N 91
            |.|||:||.|:......|:..:......|||||:.|.|::|||||:..: |.....:..|.|  |
 Frog   355 IMPRIVGGLVALPASHPYIAALYIDNHFCGGSLISPCWIVTAAHCLDQRPNVTKISVVLGQSRFN 419

  Fly    92 QAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNS------DMIGANIETIPLAAQSVPARALV 150
            ....:.|...|:...:...:...||..|:|.:::.|      ......::.|.|..|...|.:..
 Frog   420 TTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICLPQQFKMAESTK 484

  Fly   151 K--VSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIH--RITRSMVCAARLY-KKDSCDG 210
            :  |:|||.....|...|..:....:|:.....|.|.  .:|  |:...|:||..:. ..|:|.|
 Frog   485 QCVVAGWGHQYEGAEHYAFFLQEASMPIIPYTQCQSP--SVHGDRMLPGMLCAGFMEGGVDACQG 547

  Fly   211 DSGGPLVY----RGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQ 251
            |||||||.    |.:|.|:||:|.|||.. .||:||:|....||.:
 Frog   548 DSGGPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWIR 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 71/234 (30%)
Tryp_SPc 34..253 CDD:238113 72/237 (30%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 72/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.