DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AGBE and Mal-A8

DIOPT Version :9

Sequence 1:NP_788342.1 Gene:AGBE / 326264 FlyBaseID:FBgn0053138 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster


Alignment Length:478 Identity:109/478 - (22%)
Similarity:158/478 - (33%) Gaps:159/478 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 FGYQVTSFYAASSRYGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHD 298
            |||.::.|:.....||..|..:.:|..|....|.::||.|.:|:|            ..|.:|..
  Fly    89 FGYDISDFFDIQPEYGTLEDFRTLIKRAKELDLKIVLDFVPNHSS------------NESEWFLK 141

  Fly   299 GARGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHD-EYNFDGYRFDGVTSMLYHSRGIGEGFSGDY 362
            ..:.|.        .|.:|.|          ||| :.|....:.:..|:.|.:.||....::...
  Fly   142 SVKREK--------GYEDYYV----------WHDGKVNSTTGKREPPTNWLQYFRGSAWEWNEVR 188

  Fly   363 NEYF--GLNVDTDALNYLGLANHLLHTIDSRIIT--IAEDVSG-----MPTLCR--PVSEGGIGF 416
            .:|:  ...|....|||   .|.|:.....|::.  :.|.|||     :|.|..  |.|:|    
  Fly   189 QQYYLHQFAVQQPDLNY---RNPLVVEQMKRVLRYWLNEGVSGFRCDALPPLFEVVPDSDG---- 246

  Fly   417 DYRLGMAIPDKWIELLKEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLMD 481
                  ..||   |::...::|:.|...|            |..|.|:..:.:            
  Fly   247 ------QFPD---EVVSGATEDKEDRDYL------------TTTYIENQPETI------------ 278

  Fly   482 KEMYTHMSTLSDSSVIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVGNNDSYH 546
             :|.....|:.|.          ||.|      .||.:.:..:  |...|.|......||. |..
  Fly   279 -DMVYQWRTVLDD----------HKRI------FGGNSSVLLI--ETYSPAWFTMQFYGNR-STE 323

  Fly   547 YARRQWNLVDDDLLKYKYLNEFDRAMNEAEERYGWLHSGPA-----WVSWKHEGDKIIAFERAG- 605
            .|...:|.....:::...|:    |.|..|....||.:.||     ||...|  ||..|..|.| 
  Fly   324 GAHLPFNFNLITVMEQSGLS----ASNVQEAIDLWLKNMPAGRTPNWVLGNH--DKRRAASRYGK 382

  Fly   606 --------LVFVFNFHPQQSFT--GYRVG-----TNWAGTYQAVLSSDDPLFGGHNRIDANCKHP 655
                    ||.:.   |..|.|  |..:|     .:|..|.       ||.         .|.  
  Fly   383 ENIDGMNMLVMIL---PGVSVTYQGEEIGMTDGEISWEDTV-------DPW---------GCN-- 426

  Fly   656 SNPEGYAGRSNFIEVYT--PSRT 676
            |||       |..|.||  |.||
  Fly   427 SNP-------NIYEQYTRDPERT 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AGBENP_788342.1 GlgB 52..682 CDD:223373 109/478 (23%)
E_set_GBE_euk_N 62..161 CDD:199884
AmyAc_bac_euk_BE 167..570 CDD:200460 72/347 (21%)
Alpha-amylase_C 588..683 CDD:280898 30/107 (28%)
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 109/478 (23%)
trehalose_treC 33..585 CDD:274115 109/478 (23%)
Malt_amylase_C 487..585 CDD:295440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.