DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AGBE and Mal-B2

DIOPT Version :9

Sequence 1:NP_788342.1 Gene:AGBE / 326264 FlyBaseID:FBgn0053138 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_001188791.2 Gene:Mal-B2 / 34598 FlyBaseID:FBgn0032382 Length:583 Species:Drosophila melanogaster


Alignment Length:495 Identity:87/495 - (17%)
Similarity:163/495 - (32%) Gaps:166/495 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 FGYQVTSFYAASSRYGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQ---------------- 282
            |||.::.:.|....||..:..:.:||.|...|:.|:||.|.:|:|...:                
  Fly    90 FGYDISDYKAIQPEYGTMQDFEELIDTAFELGIKVVLDFVPNHSSDQHEWFKKSAAREPGYEDFY 154

  Fly   283 ---DGLNQFDGTN-------SCFF------HDGARGEHSLW----DSRLFNYVEYEVLRFLLSNL 327
               ||:.|.:||.       |.|:      |:| |.::.|.    :....||...:|::.:...|
  Fly   155 VWHDGIVQENGTRVPPNNWPSVFYGSAWEWHEG-REQYYLHQFTKEQPDLNYRNPKVVQAMDDVL 218

  Fly   328 RWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSGDYNEYFGLNVDTDALNY--------------L 378
            .:|.:: ...|:|.|.|..:........|..||.         .||:|:|              |
  Fly   219 LFWLNK-GVAGFRIDAVNHLFEDESLKDEPLSGK---------TTDSLSYDYTKHIYSRDLPEVL 273

  Fly   379 GLANHLLHTID----------SRIITIAEDVSGMPTLC------RPVSEGGIGFDYRLGMAIP-- 425
            .:.:|....:|          :||: :.|..:|:..|.      ..|....:.|::.....:.  
  Fly   274 EMIHHWRQLLDDFSAKHPERPTRIM-MTEAYAGLTQLADYYEDSNGVRGSHLPFNFHFITDVKGD 337

  Fly   426 ----------DKWIELLKEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLM 480
                      :||:..:.......|.|||                    ||...|..:.      
  Fly   338 SDARDYVYNVEKWLIYMPRGHAANWVMGN--------------------HDNPRVASRF------ 376

  Fly   481 DKEMYTHMSTLSDSSVIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEW--LDFPRVGNND 543
                                |.|....:.::...|.|.| :.:.|.|.|..::  |.:....:..
  Fly   377 --------------------GPASVDAMNMLLLTLPGVA-VTYNGEELGMVDYRELSWEETVDPP 420

  Fly   544 SYHYARRQWNLVDDDLLK--YKYLNEFDRAMNEAEERYGWLHSGPAWVSWKHEGDKI-------- 598
            :.:...:.:..|..|.::  :::.||.:...:.|.:.  ||...|.::....|..|:        
  Fly   421 ARNVGEKLYQEVSRDPVRTPFQWNNETNAGFSTAAKT--WLPVHPNYLELNLEAQKVANRSHYQV 483

  Fly   599 ----IAFERAGLVFV--FNFHPQQSFTGYRVGTNWAGTYQ 632
                :...::.::.|  ||..|.         |.|...::
  Fly   484 YKDLLELRKSAIMRVGRFNIEPL---------TRWVFAFK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AGBENP_788342.1 GlgB 52..682 CDD:223373 87/495 (18%)
E_set_GBE_euk_N 62..161 CDD:199884
AmyAc_bac_euk_BE 167..570 CDD:200460 75/417 (18%)
Alpha-amylase_C 588..683 CDD:280898 8/59 (14%)
Mal-B2NP_001188791.2 AmyAc_maltase 33..502 CDD:200467 82/472 (17%)
Malt_amylase_C 510..>541 CDD:351862 0/5 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.