DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AGBE and Mal-B1

DIOPT Version :10

Sequence 1:NP_788342.1 Gene:AGBE / 326264 FlyBaseID:FBgn0053138 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster


Alignment Length:84 Identity:17/84 - (20%)
Similarity:26/84 - (30%) Gaps:25/84 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRARETTEGALVRNDSFSH--ALHR-----------------------ILLIGDCKKLAIGFAGK 44
            ||..:|......|:|..|.  .||:                       .:||.....|....:|.
  Fly   232 LRLLKTLPDVRQRSDGMSEVWVLHQRALRCAELLELVLQPLLLMQFVLCILIWCMMLLYFTVSGL 296

  Fly    45 TLFRLNTTLFFLLAHMNTY 63
            .:..:|..|.||...:.|:
  Fly   297 NVKFINMFLLFLFVSIETF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AGBENP_788342.1 PLN02447 9..685 CDD:215246 15/80 (19%)
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 17/84 (20%)

Return to query results.
Submit another query.