DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33128 and YGL258W-A

DIOPT Version :10

Sequence 1:NP_787961.1 Gene:CG33128 / 326263 FlyBaseID:FBgn0053128 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_076890.1 Gene:YGL258W-A / 852633 SGDID:S000007607 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:19/72 - (26%)
Similarity:34/72 - (47%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 EGLIDEPVFGFYLARNGSAVDGGQLTLGGTDQNLIAGEMTYTPVTQQGYWQFAVNNITWNGTVIS 288
            :|.|::.: .:.|..||..|..|.:..|..|::..|.|:...|:.|      |.|.:..|..:|.
Yeast     6 QGKIEKKI-SYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQ------AYNTLDSNSRIII 63

  Fly   289 SGCQAIA 295
            : .|::|
Yeast    64 T-VQSVA 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33128NP_787961.1 pepsin_retropepsin_like 83..403 CDD:472175 19/72 (26%)
YGL258W-ANP_076890.1 pepsin_retropepsin_like <6..>74 CDD:472175 19/72 (26%)

Return to query results.
Submit another query.