DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33128 and AT1G62290

DIOPT Version :10

Sequence 1:NP_787961.1 Gene:CG33128 / 326263 FlyBaseID:FBgn0053128 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_176419.2 Gene:AT1G62290 / 842526 AraportID:AT1G62290 Length:513 Species:Arabidopsis thaliana


Alignment Length:38 Identity:11/38 - (28%)
Similarity:20/38 - (52%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 YLSSRIALEH---GIKVLGVDCNEENTSNAEKRRERLK 215
            |:|....:.|   |..:.|.| :|:.|:|.||..:.::
plant    25 YISQMQPVTHEAYGGGLYGQD-DEKETTNLEKEAKNIE 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33128NP_787961.1 pepsin_retropepsin_like 83..403 CDD:472175 11/38 (29%)
AT1G62290NP_176419.2 PLN03146 7..>143 CDD:178691 11/38 (29%)
phytepsin 79..511 CDD:133162
SapB_2 322..355 CDD:460945
SapB_1 387..422 CDD:461575
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.