DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33128 and pgc.2

DIOPT Version :10

Sequence 1:NP_787961.1 Gene:CG33128 / 326263 FlyBaseID:FBgn0053128 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001025603.1 Gene:pgc.2 / 594991 XenbaseID:XB-GENE-964422 Length:385 Species:Xenopus tropicalis


Alignment Length:67 Identity:20/67 - (29%)
Similarity:29/67 - (43%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VIDAGDGKGYLSSRIALEHGIKVLGVDCNEENTSN----AEKRRERLKVRMKDWSRKGKINLFSS 232
            ||.|.|.:.:|.|.:|...|:...||...|..|..    |...:.:|..:.|..|..|.:   :|
 Frog    10 VIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGL---TS 71

  Fly   233 VS 234
            ||
 Frog    72 VS 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33128NP_787961.1 pepsin_retropepsin_like 83..403 CDD:472175 20/67 (30%)
pgc.2NP_001025603.1 A1_Propeptide 19..45 CDD:462326 8/25 (32%)
pepsin_retropepsin_like 71..382 CDD:472175 3/3 (100%)

Return to query results.
Submit another query.