DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33128 and CG31928

DIOPT Version :10

Sequence 1:NP_787961.1 Gene:CG33128 / 326263 FlyBaseID:FBgn0053128 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_722705.1 Gene:CG31928 / 326175 FlyBaseID:FBgn0051928 Length:418 Species:Drosophila melanogaster


Alignment Length:109 Identity:22/109 - (20%)
Similarity:44/109 - (40%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LEHGIKVLGVDCNEE------NTSNAEKRRERL-KVRMKDWSRKGKINLFSS-------VSSEQN 238
            |::.:..:.:.|..:      :..|||...:|. .|.|:....:....:|||       ..||.:
  Fly   150 LQNIVSTVNLSCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDD 214

  Fly   239 TKSQDEHFTNLLQRGSLDTLYRTATQLIDFNT-NLIELAQEYFP 281
            ::.....:..::|:     |..|| :.:||.. |::......||
  Fly   215 SRLAARKYARIIQK-----LGFTA-KFLDFKVQNMVGSCDVRFP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33128NP_787961.1 pepsin_retropepsin_like 83..403 CDD:472175 22/109 (20%)
CG31928NP_722705.1 Asp 91..416 CDD:394983 22/109 (20%)

Return to query results.
Submit another query.