DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINB11

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:387 Identity:110/387 - (28%)
Similarity:181/387 - (46%) Gaps:48/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYE- 83
            |..||    ||..:....|...|.|.:...:||:|:||:|.|.|:|..||.....|..:...:: 
Human    13 LDVFK----ELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKPGFKD 73

  Fly    84 --------RIMSNFQKHNGLRFT--------------NWLYVNETYEVRQDYNTLMKSTFMAEGK 126
                    ||.|.|    |:.|:              |.||..:|....|.|.:..:..:.|..:
Human    74 SPKCSQAGRIHSEF----GVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQ 134

  Fly   127 D---PLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKL 188
            .   ..|..:...:|:..:..|::..:..:.....:..:...||||.:|:.|.|:.:|..::|..
Human   135 TVDFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRETVK 199

  Fly   189 KVFHGDHNKKVYVRMMSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR 251
            ..|.....|.|.|.||..:|.|::|  .....|::|:|:.|:.|||||.||:....|..|||.|.
Human   200 SPFQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLN 264

  Fly   252 -------TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKI 308
                   |.|.:::|..|.|.||:||::.:.||...||.||:..:|:.. :|||| ::...|..:
Human   265 SGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSG-MSPTKGLYL 328

  Fly   309 NHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRGRV 368
            :..:|||:::::|.|.....|:..:.:: |.......||.|.||:|.||..|  |:.|.|::
Human   329 SKAIHKSYLDVSEEGTEAAAATGDSIAV-KSLPMRAQFKANHPFLFFIRHTHTNTILFCGKL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 109/383 (28%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 110/387 (28%)
RCL. /evidence=ECO:0000250 341..365 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.