DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINB7

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:388 Identity:96/388 - (24%)
Similarity:174/388 - (44%) Gaps:61/388 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPV---------DVT 76
            :|..||. |:..::...|...|.|.:...::::.:||:..:..::..:|.:..         ..:
Human    10 EFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQS 74

  Fly    77 EMAKKYERIMSNF---QKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNSI 138
            .:..:.:|:.|:.   .|...|...|.|:..:.|...:||         .|..:.|...|... :
Human    75 GLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDY---------IECAEKLYDAKVER-V 129

  Fly   139 SFSIH-------------RKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKV 190
            .|:.|             .::|..::.:..:..:..:...||||.||:.|.|::.|:|.:|....
Human   130 DFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCH 194

  Fly   191 FHGDHNKKVYVRMMSHVGRFR---IADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR- 251
            |.........|.||....:|.   |.|.|. :|:|:.: |..::|.:.||.::  ||.||..|. 
Human   195 FKSPKCSGKAVAMMHQERKFNLSVIEDPSM-KILELRY-NGGINMYVLLPEND--LSEIENKLTF 255

  Fly   252 ------TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKIN 309
                  |....:....|.|..|:|||:...|:.:.|:.||:..||..: :||||:.:.|. ..|:
Human   256 QNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGR-LYIS 319

  Fly   310 HVVHKSFIEINERG----ASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVYFRGRV 368
            .::|||:||:.|.|    |:||     :..::|:...||.|:.:.||:|:||....:.|.|:|
Human   320 RMMHKSYIEVTEEGTEATAATG-----SNIVEKQLPQSTLFRADHPFLFVIRKDDIILFSGKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 95/386 (25%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 96/388 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.