DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINH1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:373 Identity:91/373 - (24%)
Similarity:160/373 - (42%) Gaps:54/373 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYE---------RI 85
            :..|:|..|.:.||:.:...:.::.:|.|.|||.:.::||.     .|..:..|         |.
Human    58 MAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLS-----AEQLRDEEVHAGLGELLRS 117

  Fly    86 MSNFQKHNGLRFTNW-----LYVNETYEVRQDYNTLMKSTFMAEG-----KDPLSQRKASNSISF 140
            :||....|    ..|     ||...:.....|:....|..:..|.     :|   :|.|..||:.
Human   118 LSNSTARN----VTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRD---KRSALQSINE 175

  Fly   141 SIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMS 205
            ...:.:...:..::.|  ::..:.|:|||.:::...|..:|..|....:.|....:..|.|.||.
Human   176 WAAQTTDGKLPEVTKD--VERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMH 238

  Fly   206 HVGRFRIADHSYG--QIIEMPFDNSDLSMIIGLPLHNTYLSSIEKI-----LRTLSESLVENNVH 263
            ..|.:...|....  ||:|||..:...|:||.:|.|...|..:||:     |:.....:.:..|.
Human   239 RTGLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVA 303

  Fly   264 VELPKFKIKYQTELVESLKKLGI-HLIFSNTSDLSGLLTNGTGAK---INHVVHKSFIEINERGA 324
            :.|||..::...:|.:.|..||: ..|..|.:|||.:    :|.|   :..|.|.:..|::    
Human   304 ISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM----SGKKDLYLASVFHATAFELD---- 360

  Fly   325 STGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRGRVVR 370
            :.|...|.....:::.|:...|..:.||:||:||..  ::.|.||:||
Human   361 TDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 88/369 (24%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 91/373 (24%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.