DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINA6

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:359 Identity:84/359 - (23%)
Similarity:162/359 - (45%) Gaps:29/359 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPV---DVTEMAKKYERIMSNFQK 91
            ||....:.|...||:.|.:.::|:.:|..|.|..:|...|...:   ..||:.:.::.:...|.|
Human    54 LVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAK 118

  Fly    92 HN-GLRFT--NWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGMRTI 153
            .: .|..|  |.|:::.:.|:.:.::..:|..:.:|......|..|:.|...:.:.|:....:.:
Human   119 SDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIV 183

  Fly   154 SNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHSY- 217
            .....|......||||.:::.|.|...|....|:.:.|:.|....|.|.||     .:.:..|| 
Human   184 DLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMM-----LQSSTISYL 243

  Fly   218 ------GQIIEMPFDNSDLSMIIGLP---LHNTYLSSIEK-ILRTLSESLVENNVHVELPKFKIK 272
                  .|:::|.:..:.....| ||   ..||.::::.: .:...|..|..:.|.:.:||..|.
Human   244 HDSELPCQLVQMNYVGNGTVFFI-LPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTIS 307

  Fly   273 YQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQ 337
            ...:|.:.|:::||..:|:|.::.| .:|.....|.:.||||:.:::||.|..|..::....::.
Human   308 GVYDLGDVLEEMGIADLFTNQANFS-RITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLT 371

  Fly   338 KKTRASTSFKVNRPFVFLIRDKHT--VYFRGRVV 369
            .|   ....:.|:||:.:|.|..|  ..|..||:
Human   372 SK---PIILRFNQPFIIMIFDHFTWSSLFLARVM 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 82/356 (23%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 82/356 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.