DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SRP3

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:378 Identity:87/378 - (23%)
Similarity:153/378 - (40%) Gaps:82/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ESNFIASPLCIEIGISM-------------ILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIMS 87
            :||.|.||..|...|:|             ||...:.::.:||::|.      .|:|..   :.:
plant    28 DSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKTVF------RELASV---VYA 83

  Fly    88 NFQKHNGLRFT--NWLYVNETYEVRQDYNTLMKSTFMA---------EGKDPLSQRKASNSISFS 141
            :.....|.:.|  |.|:::::......:..|.::.|.|         |.::   .||..||   .
plant    84 DRSATGGPKITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEE---VRKEVNS---W 142

  Fly   142 IHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSH 206
            :...::..::.:..|.::....:.:..|.:.:.||||..|.|..|:...|:..:...|.|..||.
plant   143 VEHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSVPFMSS 207

  Fly   207 VGRFRIADHSYGQIIEMPFD------NSDLSMIIGLPLHNTYLSS-IEKILRTLSESLVENNVHV 264
            .....:..:...:::.:|:.      |...||...||.....|.. :||:..|  ...:::::..
plant   208 YENQYVRAYDGFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMAST--PGFLDSHIPT 270

  Fly   265 ---ELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGAST 326
               ||.||:|          .|..|...||.||.|..|     |.:...:.||:.:||:|.||..
plant   271 YRDELEKFRI----------PKFKIEFGFSVTSVLDRL-----GLRSMSMYHKACVEIDEEGAEA 320

  Fly   327 GEAS---------DHAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRGRV 368
            ..|:         |..|..:|     ..|..:.||:||||::.  ||.|.|::
plant   321 AAATADGDCGCSLDFVEPPKK-----IDFVADHPFLFLIREEKTGTVLFVGQI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 87/376 (23%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 87/378 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.