DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina7

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:384 Identity:91/384 - (23%)
Similarity:176/384 - (45%) Gaps:49/384 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVL-----DLPVDVT 76
            |:...|...|. :|.::..:.|...||:.|...::|:..|:..:|..::..||     |.|  |.
  Rat    55 SINADFAFRLYRKLSVENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTP--VK 117

  Fly    77 EMAKKYERIMSNFQKHNG---LRFTNWLYVNETY--------EVRQDYNTLMKSTFMAEGKDPLS 130
            |:.:.::.::.:....|.   |:..|.:::.:..        :|:..|.|.:.||      |..:
  Rat   118 ELQQGFQHLICSLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFST------DFSN 176

  Fly   131 QRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFS-KKDTKLKVFHGD 194
            ...|.:.|: |...|..|| :.:....:|::|...:|||.:::...|...|. .|..:...|..|
  Rat   177 VSAAQHEIN-SYVEKQTKG-KIVGLIQDLKLNIIMILVNYIHFKAQWANPFRVSKTEESSNFSVD 239

  Fly   195 HNKKVYVRMMSHVGRFRIADHSYGQ------IIEMPFDNSDLSMIIGLPL--HNTYLSSI--EKI 249
            .:..|.|.||..:.::    :.|..      :::|.:..:.|::.: ||.  |..::.:.  .|.
  Rat   240 KSTTVQVPMMHQLEQY----YHYVDVELNCTVLQMDYSANALALFV-LPKEGHMEWVEAAMSSKT 299

  Fly   250 LRTLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHK 314
            |:..:..|.:..|.:.:|||.|....:|..:|:|:|:...|:.::|..| :|...|.|:::..||
  Rat   300 LKKWNHLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPG-ITKDNGLKLSYAFHK 363

  Fly   315 SFIEINERGASTGEASDHAESIQKKTRA--STSFKVNRPFVFLIRDKHT--VYFRGRVV 369
            :.:.|.|.|...| ||..|.|:.:...|  ....:::|.|:.:|.:|.|  |.|.|:||
  Rat   364 AVLHIGEEGTKEG-ASPEAGSLDQPEVAPLHAVIRLDRTFLLMILEKRTRSVLFLGKVV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 88/377 (23%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 91/384 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.