DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SRP2

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:437 Identity:94/437 - (21%)
Similarity:160/437 - (36%) Gaps:133/437 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGNNKIKYLVLLLIATSVLGKFKLNLLELVMDKAESNFIASPLCIEIGI-------------SM 52
            |:..|::.    ||:...|:.....|          ||.:.||..|...:             |.
plant    35 MKNQNEVS----LLLVGKVISAVAKN----------SNCVFSPASINAVLTVTAANTDNKTLRSF 85

  Fly    53 ILMGAKGTTAEELRSVLDLPVDVTEMAK------------------------------KYERIMS 87
            ||...|.::.||..::..      |:|.                              .:|.:..
plant    86 ILSFLKSSSTEETNAIFH------ELASVVFKDGSETGGPKIAAVNGVWMEQSLSCNPDWEDLFL 144

  Fly    88 NFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGMRT 152
            ||.|.:   |....:.::..|||.|.||             .:.|..::.|...:.|.|   :.:
plant   145 NFFKAS---FAKVDFRHKAEEVRLDVNT-------------WASRHTNDLIKEILPRGS---VTS 190

  Fly   153 ISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHSY 217
            ::|         .:..|.:|:.|||:..|.|..|:.|.||..:.|.|.|..|....:..|..:..
plant   191 LTN---------WIYGNALYFKGAWEKAFDKSMTRDKPFHLLNGKSVSVPFMRSYEKQFIEAYDG 246

  Fly   218 GQIIEMPF------DNSDLSMIIGLPLHNTYLSS-IEKILRT---LSESLVENNVHV---ELPKF 269
            .:::.:|:      .|.:.||.:.||.....|.: :|:|...   |...:.|..|.|   .:|||
plant   247 FKVLRLPYRQGRDDTNREFSMYLYLPDKKGELDNLLERITSNPGFLDSHIPEYRVDVGDFRIPKF 311

  Fly   270 KIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVH-KSFIEINERGASTGEASD-- 331
            ||::..|...         :|::             .::|..:| |:.|||:|.|.....|:.  
plant   312 KIEFGFEASS---------VFND-------------FELNVSLHQKALIEIDEEGTEAAAATTVV 354

  Fly   332 -HAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRGRVVRLPNEL 375
             ...|...:.:....|..:.||:||||:..  |:.|.|::.. |:||
plant   355 VVTGSCLWEPKKKIDFVADHPFLFLIREDKTGTLLFAGQIFD-PSEL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 86/407 (21%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 90/431 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.