DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3a

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001161177.1 Gene:Serpina3a / 74069 MGIID:1921319 Length:422 Species:Mus musculus


Alignment Length:369 Identity:88/369 - (23%)
Similarity:166/369 - (44%) Gaps:42/369 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIMSNF---- 89
            :|.:.....|.:.|||.|...::::.:|||..|.||:...|...:..|..|.    |..||    
Mouse    63 KLALKNPHKNIVFSPLSISAALALMSLGAKDNTLEEILEGLKFNLTETPEAD----IHQNFGHLL 123

  Fly    90 ----QKHNGLRFT--NWLYVNETYEVRQDYNTLMKSTFMAEG--KDPLSQRKASNSISFSIHRKS 146
                |..|.::..  |.|::::..::..::....::.:.||.  .|....|:|:..|:..:.:::
Mouse   124 QMLIQPENQVQINAGNALFIDKHLQILTEFKEKARALYKAEAFTADFQLPREATKLINDYVRKQT 188

  Fly   147 HKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMS----HV 207
            ...::.:.:|  |..|.|..|||.:.:.|.|...|..:||.|..|..|..:.|.|.||.    ..
Mouse   189 QGKIKELVSD--LHRNTSMALVNFLNFQGFWNVTFDPEDTFLGNFTLDRKRTVNVPMMKTEELTT 251

  Fly   208 GRFRIADHSYGQIIEMPF-DNSDLSMII---GLPLH---NTYLSSIEKILRTLSESLVENNVHVE 265
            ..|| .:.....::|:.: .|:....|:   |...|   :....|:.|..::|...:::   .:.
Mouse   252 NYFR-DEEMQSTVMELNYIGNASFLFILPDQGRIQHVEDSLQPQSLRKWRKSLRPRMLD---ELS 312

  Fly   266 LPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK---INHVVHKSFIEINERGASTG 327
            ||||.:.....|.:.|.:|||..:||..:||||:    ||||   ::.::|::.:::.|......
Mouse   313 LPKFSLSQDYNLNDILPELGIKEVFSTQADLSGI----TGAKNIRVSQMIHQAALDVTETHTEAD 373

  Fly   328 EASDHAESIQKKTRASTSFKVNRPFVFLIRDK--HTVYFRGRVV 369
            ..:....:.|.....:...||:|.|::||.|.  .::...|:|:
Mouse   374 VITIARYNFQSAKIKAKIVKVDREFLYLILDPMFKSISVMGKVI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 87/366 (24%)
Serpina3aNP_001161177.1 SERPIN 53..416 CDD:294093 87/366 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.