DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina9

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:356 Identity:86/356 - (24%)
Similarity:157/356 - (44%) Gaps:21/356 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLP---VDVTEMAKKYERIMSNFQK 91
            |..:....|.:.||:.|...::|:.:||:..|..::...|...   |....:...:|.::.:..|
Mouse    61 LAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGFNFTWVSEPTIHMGFEYLVRSLNK 125

  Fly    92 -HNG--LRFTNWLYVNETYEVRQDYNTLMKSTFMAE--GKDPLSQRKASNSISFSIHRKSHKGMR 151
             |.|  ||..:.|::.:..:::..:...:|..:.|:  .:|..:...|...|: |...|..|| :
Mouse   126 CHQGRELRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFSNAATAQAQIN-SYVEKETKG-K 188

  Fly   152 TISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDT-KLKVFHGDHNKKVYVRMMSHVGRFRI-AD 214
            .:....:|....:.||||.:::...|...||..:| |...|.......|:|.||.....|.. .|
Mouse   189 VVDVIQDLDSQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVD 253

  Fly   215 HSYG-QIIEMPFDNSDLSMIIGLP----LHNTYLSSIEKILRTLSESLVENNVHVELPKFKIKYQ 274
            ...| .|::|.:....::..: ||    :.....|...:.||..|.||.:..:.|.:|||.|...
Mouse   254 KELGCSILQMDYRGDAVAFFV-LPGKGKMRQLEKSLSARRLRKWSRSLQKRWIKVFIPKFSISAS 317

  Fly   275 TELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKK 339
            ..|...|.|:||...|::.:|.|| :|.....:::...||:.::::|.|.....|:.....::.:
Mouse   318 YNLETILPKMGIRDAFNSNADFSG-ITKTHFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSR 381

  Fly   340 TRASTSFKVNRPFVFLIRDKHT--VYFRGRV 368
            ...|:......||:.|:.||:|  |.|.|:|
Mouse   382 DTPSSIIAFKEPFLILLLDKNTESVLFLGKV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 85/354 (24%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 85/354 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.