DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPING1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_000053.2 Gene:SERPING1 / 710 HGNCID:1228 Length:500 Species:Homo sapiens


Alignment Length:385 Identity:93/385 - (24%)
Similarity:169/385 - (43%) Gaps:63/385 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVLG----KFKLNLLEL--VMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVT 76
            :|||    .|.|.|...  .|.|.|:|...||..|...::.:|:||...|...|.|:|..|.|.|
Human   140 AVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFT 204

  Fly    77 EMAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKD--PLSQRKASNS-- 137
            .:             |..|:......|....::....:..::.||:...:.  ..|.|..||:  
Human   205 CV-------------HQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRVLSNNSD 256

  Fly   138 ---------ISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHG 193
                     ::.:.:.|..:.:.::.:|..|      ||:|.:|.|..|||.|..|.|:::.|| 
Human   257 ANLELINTWVAKNTNNKISRLLDSLPSDTRL------VLLNAIYLSAKWKTTFDPKKTRMEPFH- 314

  Fly   194 DHNKKVYVRMMSHVGRFRIADHSYGQIIEMPFD----NSDLSMIIGLPLHNTY-LSSIEK----- 248
            ..|..:.|.||:. .::.:| |...|.::....    :.:||::|.:|.:..: |..:|:     
Human   315 FKNSVIKVPMMNS-KKYPVA-HFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQALSPS 377

  Fly   249 ILRTLSESLVENNVH---VELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINH 310
            :.:.:.|.|..:...   :.||:.|:....:::..::||.. ..||...:|.| ||.....:::.
Human   378 VFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEF-FDFSYDLNLCG-LTEDPDLQVSA 440

  Fly   311 VVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVY--FRGRV 368
            :.|::.:|:.|.|.....||  |.|:   .|....|:|.:||:|::.|:...:  |.|||
Human   441 MQHQTVLELTETGVEAAAAS--AISV---ARTLLVFEVQQPFLFVLWDQQHKFPVFMGRV 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 88/375 (23%)
SERPING1NP_000053.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..118
7 X 4 AA tandem repeats of [QE]-P-T-[TQ] 85..119
C1_inh 145..495 CDD:239005 88/378 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.