DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpine3

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:418 Identity:96/418 - (22%)
Similarity:171/418 - (40%) Gaps:98/418 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLIATSVLGKFKLNLLELVMDKAE-SNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVD- 74
            |.|:.|    :|.|:|.:....:.. :||:.||..:.:.:.::...|:|.|..:|...|...|. 
  Rat    28 LWLLKT----EFALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQD 88

  Fly    75 --VTEMAKKYERIMSNFQKHNGLRFTNWLYV------------------NETYEVRQDYNTLMKS 119
              |.|........:.|..:..|:.....|::                  |.:.|: .|::....:
  Rat    89 PRVREFLHTVYITLHNSSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLEL-ADFSEPNTT 152

  Fly   120 TFMA----------EGK-DPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYY 173
            |..|          ||. .||..|..:.|...||                         |:|:.:
  Rat   153 TMEASKGTTRPSTGEGPGSPLWGRAGALSTQLSI-------------------------VSTMTF 192

  Fly   174 SGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHSYGQ----------IIEMPFDNS 228
            ..:|:.|||....:...|...|...:.|..|     .::|:.||||          ::|:.:...
  Rat   193 QSSWQQRFSSVALQPLPFTCAHGLVLQVPAM-----HQVAEVSYGQFQDAAGHKVDVLELLYLGR 252

  Fly   229 DLSMIIGLPL-HNTYLSSIE-----KILRTLSESLVENNVHVELPKFKIKYQTELVESLKKLGIH 287
            ..|:::.||. ..|.|..||     :::...:..|....:.|.||:|:|:.|.:|...|:..||.
  Rat   253 VASLLLVLPQDKGTPLDHIEPHLTARVIHLWTTRLKRARMDVFLPRFRIQNQFDLKSILRSWGIT 317

  Fly   288 LIF----SNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKV 348
            .:|    :|...:||    ..|..::.|.||:.:|::|.|..:..|:  |..:.:::| :.:||.
  Rat   318 DLFDPLKANLKGISG----RDGFYVSEVTHKAKMELSEEGTKSCAAT--AVLLLRRSR-TPAFKA 375

  Fly   349 NRPFVFLIRDKHTVYFR---GRVVRLPN 373
            :|||:||:|:.:||..|   |:|....|
  Rat   376 DRPFIFLLREHNTVAVRITHGKVANFLN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 91/401 (23%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 95/413 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.