DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina1f

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:405 Identity:93/405 - (22%)
Similarity:166/405 - (40%) Gaps:79/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLLLIATSVLGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVL-----D 70
            |.|.|....:..||    ::.......|.:.||:.:...|||:.:|:.|..::.:...|     .
Mouse    44 VALTICNVSITLFK----KMAQLSGNGNILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTG 104

  Fly    71 LPVDVTEMAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDP------- 128
            ||  ..|:.|.:..::.:..:   ....:.|....:..:.||..::.|  |:...||.       
Mouse   105 LP--EAEIHKCFWYLLHSIHQ---TEEPSSLQTGSSVFIHQDLTSVDK--FVKGVKDLYHSDMIS 162

  Fly   129 ---LSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKV 190
               ....:|...|:..:..||.|.:..|..  ||:.:....:||.:.::....:.|..:..|:|.
Mouse   163 INFTDSSQAKTQINNYVMEKSQKEIVNIVK--NLESDTFLAVVNYIIWNAKLDSNFGCRSVKVKD 225

  Fly   191 FHGDHNKKVYVRMMSHVGR---FRIADHSYGQIIEMPFDNSDLSMIIGLPLHN--TY-------- 242
            :|..:...:.|.|:.::..   ||:.|.|...::        |:::.|    |  ||        
Mouse   226 YHLGYGMTIKVPMIHNMAMHYLFRVEDLSSTVLM--------LTLLTG----NFATYFIIPDPGK 278

  Fly   243 LSSIEKIL-----RTLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIF---SNTSDLSGL 299
            :..:|:.|     |.:...|:...|.:|:|:..:....:|...:..|||..:|   :|:||:   
Mouse   279 MQKVEQSLTYPHFRRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLGITYVFNSGTNSSDM--- 340

  Fly   300 LTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTS---FKVNRPFVFLIRDKHT 361
              |.|..|...||.|:.:.|:|:|:...     ..|..||. .||.   .::||||:..|:| ||
Mouse   341 --NDTLQKSFKVVSKAVLTIDEKGSKPS-----TNSCFKKL-GSTDMGRMQLNRPFLIFIQD-HT 396

  Fly   362 ---VYFRGRVVRLPN 373
               ..|.||||...|
Mouse   397 NDVPLFLGRVVNPQN 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 86/387 (22%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 90/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.