DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb11

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_080143.1 Gene:Serpinb11 / 66957 MGIID:1914207 Length:388 Species:Mus musculus


Alignment Length:382 Identity:105/382 - (27%)
Similarity:180/382 - (47%) Gaps:33/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLP-------- 72
            |:...:|.|::. ||..:....|...|||.....:||:|:|.:|.:||::..||...        
Mouse     5 TTASTEFCLDVFKELSSNNVGENIFFSPLTTFYALSMLLLGTRGKSAEQMEKVLHYDSFSGVLKA 69

  Fly    73 --------VDVTEMAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKD-- 127
                    ..|..|...:..::|:..:.|.|...|.:|...:....:.|....:..:.|:.:.  
Mouse    70 KTKNSSECSQVGVMHPDFRALISHINQQNSLSVANRIYGTRSISFHKQYVRCCEKLYQAKLQTVD 134

  Fly   128 -PLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVF 191
             .||..:...||:..:..|::..:..:.....:..:...|||:.:|:.|.|:.:|.|::|....|
Mouse   135 FELSTEETRKSINAWVKNKTNGKITNLFAKGTIDPSSVMVLVSAIYFKGQWQNKFQKRETVKAPF 199

  Fly   192 HGDHNKKVYVRMMSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR--- 251
            |....|...|.||...|.|::|  .....|::|:|:.|:.|.|||.||:....:|.|||.|.   
Mouse   200 HMGVGKSAVVNMMYQTGTFKLAIIKEPEMQVLELPYANNKLRMIILLPVGTASVSQIEKHLNVKM 264

  Fly   252 ----TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSDLSGLLTNGTGAKINHV 311
                |...::||..|.|.:|||.:..:.:|...||.||:..||: ..:|||| ::...|..::.|
Mouse   265 LREWTNPSNMVEREVDVHIPKFSLSVKYDLNTLLKSLGMRDIFNVANADLSG-MSPDKGLYLSKV 328

  Fly   312 VHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKH-TVYFRGR 367
            ||||::::||.|.....|:..:.|: |:...:..|..|.||:|.|.|:. .:.|.|:
Mouse   329 VHKSYVDVNEEGTEAAAATGESISV-KRLPVTVQFTANCPFLFFIWDESGNILFAGK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 104/377 (28%)
Serpinb11NP_080143.1 SERPIN 4..388 CDD:294093 105/382 (27%)
RCL. /evidence=ECO:0000250 338..362 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.