DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina5

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:385 Identity:93/385 - (24%)
Similarity:181/385 - (47%) Gaps:47/385 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IATSVLGKFKLNLLELVMDKAE-SNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE- 77
            :.||....|...|...:..:|. .|...||:.:.:.:.|:.:|:...|..::...|.|.:...: 
  Rat    75 VGTSRSRDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQQGQE 139

  Fly    78 --MAKKYERIMSNF-QKHNGLRFT--NWLYVNETYEVRQDYNTLMKSTFMAE------GKDPLSQ 131
              :.|.:::::..| |..:||:.:  :.|:.:....:|..:.:.||:.:|::      | :|.|.
  Rat   140 DMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNFG-NPESA 203

  Fly   132 RKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHN 196
            :|..|..   :.:|::..:..:..|  |......|:||.:::...|:|.||..:|....:|....
  Rat   204 KKQINDY---VAKKTNGKIVDLIKD--LDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPK 263

  Fly   197 KKVYVRMMSHVGRFRIADHSYGQIIEMPFDNSDLSMIIGLPLH-NTYLSSI-------------- 246
            |.:.|.||:.       :..|..|:    |.:....::|:|.. ||:...|              
  Rat   264 KTIQVPMMNR-------EDIYSYIL----DQNISCTVVGIPYQGNTFALFILPSEGKMKRVEDGL 317

  Fly   247 -EKILRTLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINH 310
             |:.||...:...:..:.:.||||.|:...:|.:.|.||||..||:..:|||| ||:.|..|::.
  Rat   318 DERTLRNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTTHADLSG-LTDHTNIKLSE 381

  Fly   311 VVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVYFRGRVVR 370
            :||||.:|::|.|.:...::....:::....:|...:..|||:.:|.|...:||.|:|::
  Rat   382 MVHKSMVEVDESGTTAAASTGILFTLRSARPSSLKVEFTRPFLVVIMDGTNLYFIGKVIQ 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 90/374 (24%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 90/375 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.