DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3i

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:398 Identity:94/398 - (23%)
Similarity:162/398 - (40%) Gaps:88/398 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD-LPVDVTEMAKKYERIMSNFQKH 92
            :||:...:.|.:.||..|...::::.:|||..|   |:.:|: |..::||..:.        ..|
Mouse    86 KLVLKNPDENVVFSPFSIFTALALLSLGAKSNT---LKEILEGLKFNLTETPEP--------DIH 139

  Fly    93 NGLRFT----------------NWLYVNETYEVRQDYNTLMKSTFMAEG--KDPLSQRKASNSIS 139
            .|.|:.                :.|:|.:..::..::....::.:.||.  .|.|...:|...|:
Mouse   140 QGFRYLLDLLSQPGDQVQISTGSALFVEKHLQILAEFKEKARALYQAEAFTADFLQPCQAKKLIN 204

  Fly   140 FSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGA--------------WKTRFSKKDTKLKV 190
            ..:..::...::.:.:|  |..:...||||.:|:.|.              ||..|..:||....
Mouse   205 DYVSNQTQGKIKELISD--LDKSTLMVLVNYIYFKGGRGHCLGVEREELGKWKMPFDPRDTFNSK 267

  Fly   191 FHGDHNKKVYVRMMS----HVGRFRIADHSYGQIIEMPFDNSDLSMIIGLP----LHNTYLSSIE 247
            |:.|..:.|.|.||.    ....|| .|.....::|:.:..:..::.| ||    :.....|...
Mouse   268 FYLDEKRSVKVPMMKIEELTTPYFR-DDELSCSVVELKYTGNASALFI-LPDQGKMQQVETSLHP 330

  Fly   248 KILRTLSESLVENNV-HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHV 311
            :.||....||..:.: .:.||||.|.....|...|..|||..:||..:|||. :|.....:::.|
Mouse   331 ETLRKWKNSLKPSRISELHLPKFSISNDYSLEHVLPVLGIREVFSMQADLSA-ITGTMDLRVSQV 394

  Fly   312 VHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVN--------------RPFVFLIRD--KH 360
            |||:.:::.|.|.   ||:           |:|..|||              |||:.:|.|  .|
Mouse   395 VHKAVLDVTETGT---EAA-----------AATGVKVNLRCGKIYSMTIYFKRPFLIIISDINTH 445

  Fly   361 TVYFRGRV 368
            ...|..:|
Mouse   446 IALFMAKV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 93/396 (23%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 94/398 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.