DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and LOC569077

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:372 Identity:105/372 - (28%)
Similarity:180/372 - (48%) Gaps:30/372 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLE-LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIM 86
            |.|:|.: |....||.|...|||.|...:||:.:||:|.||.|:..||.|. .|:::...:|.::
Zfish    11 FALDLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEMERVLSLS-SVSDVHSHFESLI 74

  Fly    87 SNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGK--DPLSQRKASNS-ISFSIHRK 145
            |:....:.   ||..|.||..:::....:........:.||.:  |.:...:.|.. |:..:.::
Zfish    75 SSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGASEGSRQLINKWVEKQ 139

  Fly   146 SHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGR- 209
            :...:|.:.....:.......|||.:|:.|.|...|..|.|:...|..:..:...||||..:.: 
Zfish   140 TENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPVRMMHQLNKL 204

  Fly   210 -FRIADHSYGQIIEMPFDNSDLSMIIGLPLH----NTYLSSIEKILRTLSESL---------VEN 260
             ||.......|::|:|:...:|||:|.||..    :..|..:||.| ||.:.|         .:.
Zfish   205 PFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKEL-TLEKLLDWTNRDKMDTQG 268

  Fly   261 NVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKINHVVHKSFIEINERGA 324
            .|.|.|||||::.::.|.|:|:|:|:..:|..| :||:|:.:|| |..::.|:||:|::::|.|.
Zfish   269 AVIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMGSNG-GLFVSAVIHKAFVDVSEEGT 332

  Fly   325 STGEAS--DHAESIQKKTRASTSFKVNRPFVFLIR--DKHTVYFRGR 367
            ....|:  ....|...:......|..:.||:|.||  ..:.:.|.||
Zfish   333 EAAAATCVYIITSYVPRPEPRYYFTADHPFMFFIRHNPSNNILFLGR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 105/372 (28%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 105/372 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.