DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and serpine3

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001116709.1 Gene:serpine3 / 556612 ZFINID:ZDB-GENE-050309-223 Length:417 Species:Danio rerio


Alignment Length:406 Identity:101/406 - (24%)
Similarity:186/406 - (45%) Gaps:66/406 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IATSVLG--------KFKLNLLE-LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD 70
            :|.|||.        :|.::|.: |...:.:||.|.||..:.:.:.::.:||:|.|..:|...|.
Zfish    21 VANSVLSSSFSDLHTQFGISLYQTLTETENKSNLIVSPASVSLCLGLLQLGARGNTLVQLEGTLG 85

  Fly    71 LPVD---VTEMAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDY--------NTLMKST---- 120
            ..|:   |..:..:.:..::|..:...|:..|.|::....::..::        ||.:.|.    
Zfish    86 YDVNDVRVQNILSRPQGDLANSSEGLRLQLANALFIQTGVKLLPEFTQHALGWGNTSLLSVNFSN 150

  Fly   121 -------------FMAEGKDPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVY 172
                         :.::..|.|..|:       .:|..|.:.......||.|.:    .||:|:.
Zfish   151 PNHTHSRLQQWAHYQSKADDHLQTRE-------ELHHSSGEEEEATRQDHLLYM----ALVSTLV 204

  Fly   173 YSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMM-----SHVGRFRIADHSYGQIIEMPFDNSDLSM 232
            :.|||:.:|...:|:...|.......|.|.||     .::|.||:.......::|:|:.:..|.:
Zfish   205 FHGAWQKQFLFTETQNLPFTFSDGSTVKVPMMYQSSEVNIGHFRLPSEQEYTVLELPYLDHSLRL 269

  Fly   233 IIGLPL-HNTYLSSIEKILRTLSESLVENNVH-----VELPKFKIKYQTELVESLKKLGIHLIFS 291
            ::.||. ..|.||.:||.:...:..|.:..:.     :.||:||::.:..|...|:.||:..|||
Zfish   270 LVALPSDRKTPLSQLEKQITARAVGLWDTGLRRTKMDIFLPRFKMQSKINLKPVLQSLGVSDIFS 334

  Fly   292 -NTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFL 355
             :.:|..| :::..|..::...|::.||:.|.|  |..||..|..:.|::| |..||.:|||:|:
Zfish   335 PSAADFRG-ISDTDGIFVSEAFHEARIEVTEAG--TKAASATAMVLLKRSR-SAVFKADRPFLFI 395

  Fly   356 IRDKHT--VYFRGRVV 369
            :|...|  :.|.||||
Zfish   396 LRQISTGSLLFIGRVV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 94/388 (24%)
serpine3NP_001116709.1 Serpin 35..413 CDD:278507 97/392 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.