DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINB13

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:392 Identity:104/392 - (26%)
Similarity:176/392 - (44%) Gaps:79/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD---------LPVDVTEMAK---------KY 82
            :.|...||:.|...|.|:|:|.:|.||.:|..|..         :..:..|:.:         ..
Human    24 DGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRIKAEGKEIENT 88

  Fly    83 ERIMSNFQK----------HNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPL-------S 130
            |.:...|||          ...|..||.|:..:||...|.|...::..:.| ..:|:       .
Human    89 EAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHA-SLEPVDFVNAADE 152

  Fly   131 QRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDH 195
            .||..||   .:..|:::.::.:..|.::..:...||||.||:.|.|...|.|::||.:.|..:.
Human   153 SRKKINS---WVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNK 214

  Fly   196 NKKVYVRMM--SHVGRFRIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLS-ESL 257
            :....|:||  ||...|...:....:|:.:|:.|:||||.:.||   ..:..:|||:..:| |.|
Human   215 STSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLP---NDIDGLEKIIDKISPEKL 276

  Fly   258 V---------ENNVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSDLSGLLTNGTGAKINHVV 312
            |         |..|::.||:|:::...:|...|..:|:...|| :.:|.|| :::|:|......:
Human   277 VEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSG-MSSGSGLYAQKFL 340

  Fly   313 HKSFIEINERG----ASTG------EASDHAESIQKKTRASTSFKVNRPFVFLIR--DKHTVYFR 365
            |.||:.:.|.|    |:||      .|..| |::.          .|.||:|.||  :.:::.|.
Human   341 HSSFVAVTEEGTEAAAATGIGFTVTSAPGH-ENVH----------CNHPFLFFIRHNESNSILFF 394

  Fly   366 GR 367
            ||
Human   395 GR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 104/392 (27%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 104/392 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.