DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINB9

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:372 Identity:99/372 - (26%)
Similarity:170/372 - (45%) Gaps:33/372 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFKLNLLE-LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYER 84
            |.|.:.||: |..|....|...||:.|...::|:|:||||.||.::...|.|..: .::.:.::.
Human     9 GTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTE-EDIHRAFQS 72

  Fly    85 IMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNS---ISFSIH 143
            :::...|...   ||..|.|:..:|.:....:.......:.||.|:....|.|..|   |:..:.
Human    73 LLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVS 137

  Fly   144 RKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMM---- 204
            :|:...:..:....::......||||.:|:.|.|...|.:..|:...|..:..::..|:||    
Human   138 KKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEA 202

  Fly   205 ----SHVGRFRIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR-------TLSESLV 258
                :|||..|      .|::|:|:...:||:::.||.....||::||.|.       |..:.:.
Human   203 TFKLAHVGEVR------AQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMK 261

  Fly   259 ENNVHVELPKFKIKYQTELVESLKKLGIHLIF-SNTSDLSGLLTNGTGAKINHVVHKSFIEINER 322
            ...|.|.|||||::...::...|:.|||...| ...:|||.:... ....::..|||||:|:||.
Human   262 STEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAE-RDLCLSKFVHKSFVEVNEE 325

  Fly   323 GASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDK--HTVYFRGR 367
            |.....||......:....:...|..:.||:|.||..  :::.|.||
Human   326 GTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 98/371 (26%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 99/372 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.