DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINB8

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:372 Identity:106/372 - (28%)
Similarity:184/372 - (49%) Gaps:35/372 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYER 84
            |.|.::|.:::.::..| |...||:.|...::|:.|||||:||.::...|.|..| .::.:.::.
Human     9 GTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKD-GDIHRGFQS 72

  Fly    85 IMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAE------GKDPLSQRKASNSISF 140
            ::|...:...   ||..|.|:..:|.:...|:....:..:.||      .:|....||..|.   
Human    73 LLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHIND--- 134

  Fly   141 SIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMS 205
            .:..|:...:..:.:...:......||||.:|:.|.|..:|.:|.|:..:|..:..||. |:||.
Human   135 WVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKT-VQMMF 198

  Fly   206 HVGRFRI--ADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR-------TLSESLVENN 261
            ...:|::  ||..:.|::|:|:...:|||:|.||..||.|:.:||.|.       |.||.|.::.
Human   199 KEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSK 263

  Fly   262 VHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKINHVVHKSFIEINERGAS 325
            |.|.||:.|::...:|...|::||:...|... :|.||:.|. ....::.|.||.|:|:||.|..
Human   264 VQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTE-KNVPLSKVAHKCFVEVNEEGTE 327

  Fly   326 TGEASDHAESIQKKTRAS---TSFKVNRPFVFLIRDKHT--VYFRGR 367
            ...|:    ::.:.:|.|   ..|..:.||:|.||...|  :.|.||
Human   328 AAAAT----AVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 105/371 (28%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 106/372 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.