DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINB6

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:383 Identity:102/383 - (26%)
Similarity:184/383 - (48%) Gaps:30/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLIATSVL-------GKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVL 69
            ||.|.::::       |.|.||||:.:......|...||:.:...::|:.|||||.||.::..:|
Human    71 LLHIKSAIMDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQIL 135

  Fly    70 DLPVD--VTEMAKKYERIMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGK--D 127
            .....  ..::.:.::.:::...|...   ||..|.|:..::.:....:....:..:.||.:  |
Human   136 SFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELD 200

  Fly   128 PLSQ-RKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVF 191
            .:|. .|:...|:..:..|:...:..:.:..::......||||.||:.|.|..:|.|::|:.::|
Human   201 FISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLF 265

  Fly   192 HGDHNKKVYVRMMSHVGRFR--IADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR--- 251
            ....|::..|:||.....|:  .....:.||:.:|:...:|:|||.||...|.|.::||.|.   
Human   266 KVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEK 330

  Fly   252 ----TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSDLSGLLTNGTGAKINHV 311
                |..:.:.|..|.|.||:||::...::...|:.||:...|. ..:|.||:  :.|...::.|
Human   331 FVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM--SQTDLSLSKV 393

  Fly   312 VHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGR 367
            |||||:|:||.|.... |:..|..:.:..|....|..:.||:|.|:...|  :.|.||
Human   394 VHKSFVEVNEEGTEAA-AATAAIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 98/366 (27%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 99/372 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.