DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINA1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:402 Identity:103/402 - (25%)
Similarity:170/402 - (42%) Gaps:73/402 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKIKYLVLLLIATSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSV 68
            |||         |..|.:|..:|. :|......:|...||:.|....:|:.:|.|..|.:|:...
Human    48 NKI---------TPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEG 103

  Fly    69 LDLPVDVTEMAKKYERIMSNFQKHNG----LRFTNWLYVNETYEVRQDYNTLMKST----FMAEG 125
            |:.  ::||:.:.        |.|.|    ||..|           |..:.|..:|    |::||
Human   104 LNF--NLTEIPEA--------QIHEGFQELLRTLN-----------QPDSQLQLTTGNGLFLSEG 147

  Fly   126 KDPLSQ-----RKASNSISFSIHRKSHKGMRTISNDH--------------NLQINESAVLVNTV 171
            ...:.:     :|..:|.:|:::....:..:...||:              .|..:....|||.:
Human   148 LKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYI 212

  Fly   172 YYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHS---YGQIIEMPFDNSDLSMI 233
            ::.|.|:..|..|||:.:.||.|....|.|.||..:|.|.| .|.   ...::.|.: ..:.:.|
Human   213 FFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNI-QHCKKLSSWVLLMKY-LGNATAI 275

  Fly   234 IGLPLHNTYLSSIEKILRTLSESLVEN----NVHVELPKFKIKYQTELVESLKKLGIHLIFSNTS 294
            ..||..........::...:....:||    :..:.|||..|....:|...|.:|||..:|||.:
Human   276 FFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGA 340

  Fly   295 DLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDK 359
            |||| :|.....|::..|||:.:.|:|:|.....|. ..|:|.........|  |:|||||:.::
Human   341 DLSG-VTEEAPLKLSKAVHKAVLTIDEKGTEAAGAM-FLEAIPMSIPPEVKF--NKPFVFLMIEQ 401

  Fly   360 HT--VYFRGRVV 369
            :|  ..|.|:||
Human   402 NTKSPLFMGKVV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 96/382 (25%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 96/383 (25%)
RCL 368..392 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.