DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINF1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:365 Identity:83/365 - (22%)
Similarity:163/365 - (44%) Gaps:59/365 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SNFIASPLCIEIGISMILMGAKGTTAEELRSVL--DLPVDVTEMAKKYERIM-------SNFQKH 92
            :|.:.|||.:...:|.:.:||:..|...:...|  || :...::...|:.::       .|.:..
Human    76 TNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDL-ISSPDIHGTYKELLDTVTAPQKNLKSA 139

  Fly    93 NGLRFTNWLYVNETY--EVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGMRTISN 155
            :.:.|...|.:..::  .:.:.|.|..:   :..|...|..::.:|.:...:..|..:..:.|.:
Human   140 SRIVFEKKLRIKSSFVAPLEKSYGTRPR---VLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPD 201

  Fly   156 DHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSH---VGRFRIADHSY 217
            :      .|.:|:...::.|.|.|:|..:.|.|:.|:.|..:.|.|.|||.   |.|:.:.....
Human   202 E------ISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLS 260

  Fly   218 GQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLSESLVENNVH------------VELPKFK 270
            .:|.::|...| :|:|..|||      .:.:.|..:.|||....:|            :.:||.|
Human   261 CKIAQLPLTGS-MSIIFFLPL------KVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLK 318

  Fly   271 IKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGAST----GEASD 331
            :.|:.|:.:||:::.:..:| ::.|.|.:  .|...|:..|.|::..|.||.||.|    |....
Human   319 LSYEGEVTKSLQEMKLQSLF-DSPDFSKI--TGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPA 380

  Fly   332 HAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRVV 369
            |       ......:.:|:||:|::||..|  :.|.|:::
Human   381 H-------LTFPLDYHLNQPFIFVLRDTDTGALLFIGKIL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 83/362 (23%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 83/365 (23%)
O-glycosylated at one site 371..383 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.