DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINA5

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:374 Identity:89/374 - (23%)
Similarity:179/374 - (47%) Gaps:26/374 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IATSVLGKFKLNLLELVMDKAESNFI-ASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVT-- 76
            :|.|....|..:|...:...|.|..| .||:.|.:.::|:.:||..:|..::...|.|.:..:  
Human    40 VAPSSRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSE 104

  Fly    77 -EMAKKYERIMSNF-QKHNGLRFT--NWLYVNETYEVRQDYNTLMKSTFMAEG-----KDPLSQR 132
             |:.:.:::::... |..:|.:.:  |.|:.:...:::..:.:.||:.::|:.     :|.....
Human   105 KELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAM 169

  Fly   133 KASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNK 197
            |..|...    .|..|| :.:....||..|...::||.:::...|:|.|:.|.|:.:.|:.....
Human   170 KQINDYV----AKQTKG-KIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSET 229

  Fly   198 KVYVRMMSHVGRFR-IADHSYG-QIIEMPFDNSDLSMIIGLP----LHNTYLSSIEKILRTLSES 256
            .|.|.|||...::. :.|.:.. :::.:|:..:..::.| ||    :........||.||...:.
Human   230 VVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFI-LPSEGKMQQVENGLSEKTLRKWLKM 293

  Fly   257 LVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINE 321
            ..:..:.:.||||.|:...:|.:.|..|||..:|::.:|||| ::|.:..:::.:|||:.:|::|
Human   294 FKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSG-ISNHSNIQVSEMVHKAVVEVDE 357

  Fly   322 RGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVYFRGRVVR 370
            .|.....|:....:.:.....|.....||||:..|.| :.:.|.|:|.|
Human   358 SGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVD-NNILFLGKVNR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 85/363 (23%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 85/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.