DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and serpinb1l1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:383 Identity:100/383 - (26%)
Similarity:178/383 - (46%) Gaps:47/383 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFKLNLLELVM-DKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERI 85
            :|.|||.:.:. ..|..|...||:.|...::|:.:||||.||:::..||...   ::..:..|:|
Zfish    10 QFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFN---SQAHQPVEQI 71

  Fly    86 MSNFQKHNG----------LRFTNWLYVNETYEV--------RQDYNT-LMKSTFMAEGKDPLSQ 131
            .|||:|...          |...|.||..:||::        ::.|:. |.|..|:.:.:|    
Zfish    72 HSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSED---- 132

  Fly   132 RKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHN 196
              |..:|:..:.:.:.:.::.:.....:......||||.:|:.|.|:.:|.|:.|:..||..:.|
Zfish   133 --ARVNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKN 195

  Fly   197 KKVYVRMMSHVGRF--RIADHSYGQIIEMPFDNSDLSMIIGLP----LHNTYLSSIEKILR---- 251
            :...|:||.....|  ...:.....::|:|:...:|||:|.||    ...|.|..:|:.|.    
Zfish   196 QTKPVKMMHQKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKL 260

  Fly   252 ---TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSDLSGLLTNGTGAKINHVV 312
               |..|.:.:..|.|.|||||.:...::...|..:|:..:|. ...:|:| :::.....::..:
Zfish   261 MEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTG-MSSSNDLVLSKAI 324

  Fly   313 HKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRV 368
            ||:|:|:||.|.....|:...|.:.... ...||..:.||:|.||...|  :.|.||:
Zfish   325 HKAFVEVNEEGTEAAAATAAIEKLMCYI-PPLSFNADHPFLFFIRHNPTKSILFYGRL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 99/381 (26%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 100/383 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.