DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Spn27A

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:378 Identity:89/378 - (23%)
Similarity:180/378 - (47%) Gaps:45/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELVM--DKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDV---TEMAKKY 82
            |..:||:.|:  :.|:.|.|.||..:::.::::...|...|..:: .:.:...|:   ..:.:.|
  Fly    76 FSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQV-ELANTQTDIRSQNNVREFY 139

  Fly    83 ERIMSNFQKHNGLRFT----NWLYVNETYEVRQDYNTLMKSTF--MAEGKDPLSQRKASNSISFS 141
            .:.:::|:|.|.|..|    ..|:.:...|.:|.:...:|..:  ..|..|..:...|:::|:..
  Fly   140 RKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAW 204

  Fly   142 IHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHG-------DHNKKV 199
            ....:...::.:....|:: :...:|.|.:|::|.|:.:|:      ..|.|       |.::..
  Fly   205 AANITQGRLQQLVAPDNVR-SSVMLLTNLIYFNGLWRRQFA------TTFQGSFFRSKDDQSRAE 262

  Fly   200 YVRMMSHVGRFRIADHSYGQIIEMPFDNSDLSMIIGLP-----LHNTYLSSIEKILRTLSESLVE 259
            ::....:. .:..::....||:.:|:...: |:.:.||     :|:...:.....|::...::.|
  Fly   263 FMEQTDYF-YYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQWAMEE 325

  Fly   260 NNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTG----AKINHVVHKSFIEIN 320
            ..|.|.||||...||..|.|:|:.||:..||.:::.|.| ||.|..    .|:::::.|:.|.:|
  Fly   326 VKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPG-LTRGADVAGKVKVSNILQKAGINVN 389

  Fly   321 ERGASTGEASDHAESIQKKTRASTS---FKVNRPFVFLIRDKHT--VYFRGRV 368
            |:|.....|:  ...|:.|...||:   |.|||||||.|.::.|  :.|.|:|
  Fly   390 EKGTEAYAAT--VVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 88/376 (23%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 88/376 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.