DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Spn43Aa

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster


Alignment Length:357 Identity:101/357 - (28%)
Similarity:181/357 - (50%) Gaps:21/357 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE--MAKKYERIMSNFQKH 92
            |..|:.:.|.|.||:.|::.:.:...||:|.||.||:..|......::  :|:.|..::.::.|.
  Fly    38 LATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHNLLHSYIKS 102

  Fly    93 NG-LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHR-----KSHKGMR 151
            .. |...|.:|..:...|...:..:.:..|.:| .:||...:.:.::. .|:|     ..:|..|
  Fly   103 KTVLEIANKVYTRQNLTVSSHFREVAQKYFDSE-VEPLDFSRETEAVE-QINRWVKQQTENKIER 165

  Fly   152 TISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHS 216
            .:   .:|:.:.:..|||.:|:...|...|:.:||:.:.|....::.:.|..|.....:..||:.
  Fly   166 VV---ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYP 227

  Fly   217 Y--GQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLSESLVEN-----NVHVELPKFKIKYQ 274
            .  .:.||:.|:|.:|:|...||...:.|.::|:.|:.:..:|:|:     :|.|.|||||.::.
  Fly   228 ELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFD 292

  Fly   275 TELVESLKKLGIHLIFSNTSDLSGLLTNG-TGAKINHVVHKSFIEINERGASTGEASDHAESIQK 338
            |:|..:|.|:||..:||:.:|.|.:..:. .|.:|..|.||:||::||.|.....||..|.....
  Fly   293 TDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMS 357

  Fly   339 KTRASTSFKVNRPFVFLIRDKHTVYFRGRVVR 370
            ......:|..:.||.|:|||||.|||.|.:|:
  Fly   358 LPLDPKTFVADHPFAFIIRDKHAVYFTGHIVK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 100/353 (28%)
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 100/353 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446404
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.