DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:390 Identity:105/390 - (26%)
Similarity:191/390 - (48%) Gaps:43/390 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYLVL--LLIATSVLGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD 70
            :|.::  ||.|.:.   |.|.|..::.:.:..|...|...:...:::|||||.||||.::..||.
Mouse    49 RYTIMDSLLEANAT---FTLKLFRVLGEDSSKNVFFSSSSMFSSLALILMGANGTTASQISQVLS 110

  Fly    71 LP------VDVTEMAKKYERIMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAE-- 124
            |.      .||.:   .::.:::...|.:.   ||..|.::.:..:::.:.:.......:..|  
Mouse   111 LDKCSNGGADVQQ---GFQSLLTEVNKTDTGHMLRRANKIFSDNNFDIMESFKESCYKLYRVEIE 172

  Fly   125 -----GKDPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKK 184
                 |    :..:....|:..:.:|:...:|.:.:.:.:..|...:|||..|:.|.|:.:|:|:
Mouse   173 KLDFKG----TPEQCRQHINAWVAKKTKDVIRELLSLYTVNSNTRLILVNATYFKGKWEKQFNKE 233

  Fly   185 DTKLKVFHGDHNKKVYVRMMSHVGRFR--IADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIE 247
            ||:...|....|:|..|:|||....|:  .|:.....|:.:|:.:.:|||||.||.....||.:|
Mouse   234 DTREMPFKVSKNEKKTVQMMSKKSTFKTYYAEEISTTIVFLPYTDKELSMIIMLPDEQVELSMVE 298

  Fly   248 ------KILR-TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGT 304
                  |::: |....:.|..|.|.||:||::...::.:.|.|||:...|..: :|.|| :::..
Mouse   299 NQISYKKLIQWTRLVKMEEEEVQVFLPRFKLEATYDMKDVLCKLGMTDAFEESRADFSG-ISSKK 362

  Fly   305 GAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIR-DK-HTVYFRGR 367
            |..:::||||||:|:||.|.....|::........|:  .....:|||:|||: || ..:.|.||
Mouse   363 GLFLSNVVHKSFVEVNEEGTEAAVATEIVTVGSPLTQ--RCLIADRPFLFLIQGDKSKEILFLGR 425

  Fly   368  367
            Mouse   426  425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 101/374 (27%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 104/386 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.