DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Spn77Ba

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:413 Identity:97/413 - (23%)
Similarity:180/413 - (43%) Gaps:91/413 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLLLIATSVLGKFKLNLLELV---MDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLP 72
            ||:.|:..| ..|.|:||:.:   ::||..:|:.||..:...:.::..|::|.|..:|:..|.:.
  Fly    68 VLVSISQGV-QDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN 131

  Fly    73 VDVTEMAKKYERIMSNFQKHNGLRFT---------NWLYVNETYEVRQDYNTLMKSTFMAEGKDP 128
            |:..::...| ::.|:|     |..|         ..:|..:.|.::.:|...:::    ....|
  Fly   132 VEDEKLRGAY-KVWSSF-----LNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN----YNVQP 186

  Fly   129 LSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESA----------------------VLVNTV 171
            :       .:.|            .|.|..:||||..                      .|::::
  Fly   187 M-------EVDF------------YSPDSVIQINEDTNRTTRGLIPYTILPQDVYGAKMFLLSSL 232

  Fly   172 YYSGAWKTRFSKKDTKLKVFHGDHNKKV-YVRMMSHVGRFRIADHSY---GQIIEMPFDNSD-LS 231
            |:.|.||..|:|..|:.:.|..:..:.: .:.||.....|....:..   |.::|:|:...| |:
  Fly   233 YFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLA 297

  Fly   232 MIIGLPLHNTYLSSIEKILRTL-------------SESLVENNVHVELPKFKIKYQTELVESLKK 283
            ||:.||.....|:.:...|:.|             :.:..:|.|.|.:|||.......|...|.:
  Fly   298 MIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQ 362

  Fly   284 LGIHLIF-SNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFK 347
            :||..:| .||::|. .:::|..||:  |||.:.|.::|:|.:.|..:: |....|.|  ...|.
  Fly   363 MGIRDLFDENTANLD-RMSSGLFAKL--VVHSTKIIVDEQGTTAGAVTE-AALANKAT--PPKFL 421

  Fly   348 VNRPFVFLIRDKHT--VYFRGRV 368
            :||||.::|.:|.|  :.|.|:|
  Fly   422 LNRPFQYMIVEKATGLLLFAGQV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 92/400 (23%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 93/404 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.