DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Acp76A

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:408 Identity:97/408 - (23%)
Similarity:164/408 - (40%) Gaps:78/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GNNKIKYLVL---LLIATSVLGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEE 64
            ||:::.:|||   ||...::.......|:..:......||:.|.|.||    |||.......|.|
  Fly     2 GNHQVIFLVLCTSLLFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIE----MILFEIHAAKAVE 62

  Fly    65 LRSVLDLPV-----------DVTEMAKKYERIMS-NFQKHNGLRFTNWL-------YVNET---- 106
            ..:.|:..:           :|.:...:|::..| .||..|.:..:..|       .|||.    
  Fly    63 SNNDLERSLIINFGYSEARQEVLDWGLRYKKASSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTS 127

  Fly   107 ---YEVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLV 168
               |:|.:|   :..|..|.|.   ||........:|...:|.:.|             |:.|.:
  Fly   128 AKKYDVTKD---VRPSKLMDEW---LSSHLDGVLANFVQEKKLNAG-------------ENIVAI 173

  Fly   169 NTVYYSGAWKTRFSKKDTKLKVFH---GDHNK-KVYVRMMSHVGRFRIADHSYGQIIEMPFDNSD 229
            :.:..:..|.:.|..:..:..|.:   |..:| ...|.||..:..|........:.|.:||.:::
  Fly   174 SGMTVTPLWASHFQSEINRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDEAKGIYIPFSSAN 238

  Fly   230 LSMIIGLPLHNTYLSSIEKILRTLSESL-VENN----VHVELPKFKIKYQTELVESLKKLGIHLI 289
            |.|:|.||....   :.:.||..|:..: ||.|    ||:.||.||.|:...:.:....:.|...
  Fly   239 LGMLILLPRKGV---TCKDILDNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDT 300

  Fly   290 FSNTSDLSGLLTNGTGAKINHVVH-KSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFV 353
            |.:::..|.........::||.:. :..:.:        |..|..:     |..:.:|:||||||
  Fly   301 FKDSAFKSKAKIKINNFRVNHGIRFQPILRL--------EVVDDID-----TGKTETFEVNRPFV 352

  Fly   354 FLIRDKHTVYFRGRVVRL 371
            |:|:||..||..||:..|
  Fly   353 FVIKDKINVYAVGRIENL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 88/381 (23%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 88/383 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.