DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb3c

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:380 Identity:93/380 - (24%)
Similarity:184/380 - (48%) Gaps:37/380 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE-------- 77
            |||.:.:...:.: ::.|...||:.:...:.|:.:||||.|..::..||... :.||        
Mouse     9 GKFTVEMYRQLRE-SDKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCN-ETTEKTTEKSAH 71

  Fly    78 ------MAKKYERIMSNFQKHN---GLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRK 133
                  :.::::::::...|.|   .|:..|.:|..:.:.:.|.:...:|..:.|..:....:..
Mouse    72 CDDEDNVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPLLQTFLEDIKEYYHANVESLDFEHA 136

  Fly   134 ASNS---ISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDH 195
            |..|   |:|.:..:::..::.:....:|..:...||||.||:.|.|..:|.:.:|..::|..:.
Mouse   137 AEESEKKINFWVKNETNGKIKDLFPSGSLSSSTKLVLVNAVYFKGRWNHKFDENNTIEEMFWLNK 201

  Fly   196 NKKVYVRMMSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR------- 251
            |..:.|.||....:|..:  :....||:|:|:...:|||.:.||:....|..:||.|.       
Mouse   202 NTSIPVPMMKQRNKFMFSFLEDVQAQIVEIPYKGKELSMFVLLPMEIDGLKQLEKQLTAAKLLEW 266

  Fly   252 TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSDLSGLLTNGTGAKINHVVHKS 315
            |.:|::....:::.||:||::.:.:|...|:.:|:...|. ..:|.|| :::..|..::.|:|||
Mouse   267 TRAENMHLTELYLWLPRFKVEEKYDLPVPLECMGMVNAFDPQKADFSG-MSSTQGLVVSKVLHKS 330

  Fly   316 FIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRV 368
            |:|:||.|.....||  .|.:..:......|:.:.||:|.|....|  :.|.||:
Mouse   331 FVEVNEEGTEADPAS--GEEVILRLAQVADFRCDHPFLFFIIHSKTNSILFFGRI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 91/377 (24%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 93/380 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.